Same-day dispatch · Free express shipping over €200
Alptide
Research-grade peptides — 99%+ verified purityCOA verified — every batch, independently testedShips within 24 hoursFree express shipping on orders €200+Heavy metal + endotoxin testedSecure checkout — encrypted connection
Tesamorelin

Growth-hormone-releasing-hormone analogue for controlled laboratory research.

Dose
10 mg
Batch
268007
Bestseller

Tesamorelin

trans-3-Hexenoyl-human growth hormone-releasing factor (1-44) amide — synthetic GHRH(1-44)-NH2 analog (TH9507)

4.8 · 88 researcher reviews

For research purposes only — This compound is not FDA approved. All data presented is from clinical trials for educational reference.

Growth-hormone-releasing-hormone analogue for controlled laboratory research.

€9010 mg / vial

Members get 10% off every order, on top of volume pricing — become a member with a free account.

Batch tested
HPLC + LC-MS
Same-day
Dispatch · 1–3 business days
COA included
Batch-traceable
Order quantity

Volume savings are applied automatically at checkout. Larger orders: support@alptide.at

Certificate of Analysis · 268007Current testUS lab
Lab
Freedom Diagnostics
Purity
99.32%
Methods
HPLC-UV · LC-MS
Tested
Sep 25, 2026
2 tests on fileBatch record →

For laboratory research use only. Not for human consumption.

Compound information

Technical specifications

Molecular profile · Tesamorelin
Type
Peptide
Scientific name
trans-3-Hexenoyl-human growth hormone-releasing factor (1-44) amide — synthetic GHRH(1-44)-NH2 analog (TH9507)
Amino acids
44
Sequence
YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Molecular weight
5135.9 g/mol
Formula
C221H366N72O67S
CAS
218949-48-5
Origin
Synthetic analog of human growth hormone-releasing hormone GHRH(1-44) — the mature somatoliberin peptide, UniProt P01286 residues 32-75 — carrying a C-terminal leucine amide and an N-terminal trans-3-hexenoyl group on Tyr1.
Storage requirements
Lyophilized (powder)
-20°C · stable long-term; protect from light and moisture, keep desiccated
Reconstituted
2-8°C · use within 30 days; avoid repeated freeze-thaw cycles
Room temperature
Lyophilized powder tolerates ambient temperatures during shipping for several days without meaningful loss — the marketed lyophilized formulation (EGRIFTA SV) is labeled for storage at 20-25°C before reconstitution. In solution the peptide is far less stable: the FDA label directs that reconstituted product be used immediately and not held, so aqueous material should not be left at room temperature.
Sources & references

Peer-reviewed research

Published research and registered trials involving this compound. Provided for educational reference only — none of it is a claim about this product.

  • New England Journal of Medicine
    Metabolic effects of a growth hormone-releasing factor in patients with HIV
    Falutz J, Allas S, Blot K, Potvin D, Kotler D, Somero M, Berger D, Brown S, Richmond G, Fessel J, Turner R, Grinspoon S
    2007DOI: 10.1056/NEJMoa072375PMID: 18057338
    View source →
  • Basic and Clinical Pharmacology & Toxicology
    Non-clinical pharmacology and safety evaluation of TH9507, a human growth hormone-releasing factor analogue
    Ferdinandi ES, Brazeau P, High K, Procter B, Fennell S, Dubreuil P
    2007DOI: 10.1111/j.1742-7843.2007.00008.xPMID: 17214611
    View source →
  • AIDS
    Long-term safety and effects of tesamorelin, a growth hormone-releasing factor analogue, in HIV patients with abdominal fat accumulation
    Falutz J, Allas S, Mamputu JC, Potvin D, Kotler D, Somero M, Berger D, Brown S, Richmond G, Fessel J, Turner R, Grinspoon S
    2008DOI: 10.1097/QAD.0b013e32830a5058PMID: 18690162
    View source →
  • Journal of Clinical Endocrinology and Metabolism
    Effects of tesamorelin (TH9507), a growth hormone-releasing factor analog, in human immunodeficiency virus-infected patients with excess abdominal fat: a pooled analysis of two multicenter, double-blind placebo-controlled phase 3 trials with safety extension data
    Falutz J, Mamputu JC, Potvin D, Moyle G, Soulban G, Loughrey H, Marsolais C, Turner R, Grinspoon S
    2010DOI: 10.1210/jc.2010-0490PMID: 20554713
    View source →
  • JAMA
    Effect of tesamorelin on visceral fat and liver fat in HIV-infected patients with abdominal fat accumulation: a randomized clinical trial
    Stanley TL, Feldpausch MN, Oh J, Branch KL, Lee H, Torriani M, Grinspoon SK
    2014DOI: 10.1001/jama.2014.8334PMID: 25038357
    View source →
  • The Lancet HIV
    Effects of tesamorelin on non-alcoholic fatty liver disease in HIV: a randomised, double-blind, multicentre trial
    Stanley TL, Fourman LT, Feldpausch MN, Purdy J, Zheng I, Pan CS, Aepfelbacher J, Buckless C, Tsao A, Kellogg A, Branch K, Lee H, Liu CY, Corey KE, Chung RT, Torriani M, Kleiner DE, Hadigan CM, Grinspoon SK
    2019DOI: 10.1016/S2352-3018(19)30338-8PMID: 31611038
    View source →

More in GH Secretagogues

CJC-1295 (No DAC)

CJC-1295 (No DAC)

10 mg / vial

COA verified
(214)

Growth-hormone secretagogue research peptide for controlled laboratory studies.

€90
Ipamorelin

Ipamorelin

10 mg / vial

COA verified
(331)

Growth-hormone secretagogue research peptide for controlled laboratory studies.

€45