Multi-receptor research peptide for metabolic-pathway studies.
- Dose
- 10 mg
- Batch
- 268019
GLP-3 (RT)
RT (LY3437943) — synthetic triple agonist peptide at the GIP, GLP-1 and glucagon (GCGR) receptors
For research purposes only — This compound is not FDA approved. All data presented is from clinical trials for educational reference.
Multi-receptor research peptide for metabolic-pathway studies.
Members get 10% off every order, on top of volume pricing — become a member with a free account.
Volume savings are applied automatically at checkout. Larger orders: support@alptide.at
- Lab
- Janoshik Analytical
- Purity
- 99.716%
- Methods
- HPLC · LC-MS
- Tested
- Sep 15, 2026
For laboratory research use only. Not for human consumption.
Technical specifications
- Type
- Peptide
- Scientific name
- RT (LY3437943) — synthetic triple agonist peptide at the GIP, GLP-1 and glucagon (GCGR) receptors
- Amino acids
- 39
- Sequence
- YAQGTFTSDYSILLDKKAQAAFIEYLLEGGPSSGAPPPS
- Molecular weight
- 4731 g/mol
- Formula
- C221H342N46O68
- CAS
- 2381089-83-2
- Origin
- Synthetic 39-residue GIP-backbone analogue engineered at EL; Aib at positions 2 and 20, alpha-methyl-Leu at 13, C20 fatty-diacid-acylated Lys17, C-terminal Ser amide (ChEMBL CHEMBL5095485; modification positions confirmed in Li et al., Cell Discov 2024).
- Lyophilized (powder)
- -20°C · stable long-term; protect from light and moisture. Ship/hold at 2-8°C for short periods.
- Reconstituted
- 2-8°C · use within ~30 days; avoid repeated freeze-thaw and vigorous agitation (lipidated peptides are aggregation-prone at air-liquid interfaces).
- Room temperature
- Lyophilized powder tolerates brief transit excursions, but sustained room-temperature storage is not advised — extended ambient exposure accelerates deamidation, oxidation and aggregation in long acylated peptides. Reconstituted material should not be left at room temperature.
Peer-reviewed research
Published research and registered trials involving this compound. Provided for educational reference only — none of it is a claim about this product.
- Cell MetabolismLY3437943, a novel triple glucagon, GIP, and GLP-1 receptor agonist for glycemic control and weight loss: From discovery to clinical proof of conceptCoskun T, Urva S, Roell WC, Qu H, Loghin C, Moyers JS et al.2022DOI: 10.1016/j.cmet.2022.07.013PMID: 35985340
- The LancetLY3437943, a novel triple GIP, GLP-1, and glucagon receptor agonist in people with type 2 diabetes: a phase 1b, multicentre, double-blind, placebo-controlled, randomised, multiple-ascending dose trialUrva S, Coskun T, Loh MT, Du Y, Thomas MK, Gurbuz S et al.2022DOI: 10.1016/S0140-6736(22)02033-5PMID: 36354040
- New England Journal of MedicineTriple-Hormone-Receptor Agonist RT for Obesity - A Phase 2 TrialJastreboff AM, Kaplan LM, Frías JP, Wu Q, Du Y, Gurbuz S et al.2023DOI: 10.1056/NEJMoa2301972PMID: 37366315
- The LancetRT, a GIP, GLP-1 and glucagon receptor agonist, for people with type 2 diabetes: a randomised, double-blind, placebo and active-controlled, parallel-group, phase 2 trial conducted in the USARosenstock J, Frias J, Jastreboff AM, Du Y, Lou J, Gurbuz S et al.2023DOI: 10.1016/S0140-6736(23)01053-XPMID: 37385280
- Nature MedicineTriple hormone receptor agonist RT for metabolic dysfunction-associated steatotic liver disease: a randomized phase 2a trialSanyal AJ, Kaplan LM, Frias JP, Brouwers B, Wu Q, Thomas MK et al.2024DOI: 10.1038/s41591-024-03018-2PMID: 38858523
- Cell DiscoveryStructural insights into the triple agonism at GLP-1R, GIPR and GCGR manifested by RTLi W, Zhou Q, Cong Z, Yuan Q, Li W, Zhao F et al.2024DOI: 10.1038/s41421-024-00700-0PMID: 39019866
- Diabetes, Obesity and MetabolismRT for the treatment of obesity, obstructive sleep apnea and knee osteoarthritis: Rationale and design of the TRIUMPH registrational clinical trialsGiblin K, Kaplan LM, Somers VK, Le Roux CW, Hunter DJ, Wu Q et al.2026DOI: 10.1111/dom.70209PMID: 41090431
More in Metabolic
NAD+
500 mg / vial
Metabolic cofactor supplied for cellular energy and redox-pathway research.
Bacteriostatic Water
3 mL / vial
Laboratory diluent supplied for controlled reconstitution and handling workflows.
5-Amino-1MQ
50 mg / vial
Small-molecule research compound catalogued for metabolic-pathway studies.
AOD-9604
10 mg / vial
Growth-hormone-fragment research peptide catalogued for metabolic-pathway studies.